SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG13282_complete:A_BomaMG_comp24480_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000398 P mRNA splicing, via spliceosome
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0007067 P mitotic cell cycle
GO:0007303 P cytoplasmic transport, nurse cell to oocyte
GO:0007562 P eclosion
GO:0007623 P circadian rhythm
GO:0008062 P eclosion rhythm
GO:0008104 P protein localization
GO:0008270 F zinc ion binding
GO:0009790 P embryo development
GO:0030036 P actin cytoskeleton organization
GO:0040011 P locomotion
GO:0045475 P locomotor rhythm
GO:0045804 P negative regulation of eclosion
GO:0045995 P regulation of embryonic development
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0071011 C precatalytic spliceosome
GO:0071013 C catalytic step 2 spliceosome
RNA-seq EntryA_BomaMG_comp24480_c0_seq4
Sequence
(Amino Acid)
MFVPRQDPYDGYYDRSRFDSPRDLFERRYPVGGASRGLELGGSRGARGDFVSPPLRREPM
PPMPNLPPLRSGMGSMRSSYDPMYSRRSPPPGPQMSRGMYEDFSRDTFDDRRPGMRGPSP
SRRYAPY
*(41 a.a.)

- SilkBase 1999-2023 -