SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG13169_3prime_partial:A_BomaMG_comp24440_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004016 F adenylate cyclase activity
GO:0004383 F guanylate cyclase activity
GO:0004672 F protein kinase activity
GO:0004872 F signaling receptor activity
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006182 P cGMP biosynthetic process
GO:0006468 P protein phosphorylation
GO:0007165 P signal transduction
GO:0008074 C guanylate cyclase complex, soluble
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019934 P cGMP-mediated signaling
GO:0035556 P intracellular signal transduction
RNA-seq EntryA_BomaMG_comp24440_c0_seq3
Sequence
(Amino Acid)
MFQGMIFIHESPLQYHGSLRPSNCLVDARWVVKLSDFGLKEFRRGELPPSEPTALRSHVD
SLVYLSPELLRAAGWGKDGPARGPDQHGSAAADVYAFSLVLYELHSRRGPFGA
(36 a.a.)

- SilkBase 1999-2023 -