SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG13135_3prime_partial:A_BomaMG_comp24429_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0001708 P cell fate specification
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005912 C adherens junction
GO:0006468 P protein phosphorylation
GO:0007067 P mitotic cell cycle
GO:0007298 P border follicle cell migration
GO:0007430 P terminal branching, open tracheal system
GO:0007446 P imaginal disc growth
GO:0008285 P negative regulation of cell population proliferation
GO:0008360 P regulation of cell shape
GO:0010212 P response to ionizing radiation
GO:0010906 P regulation of glucose metabolic process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0035329 P hippo signaling
GO:0042127 P regulation of cell population proliferation
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043065 P positive regulation of apoptotic process
GO:0045464 P R8 cell fate specification
GO:0045570 P regulation of imaginal disc growth
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046621 P negative regulation of organ growth
GO:0046872 F metal ion binding
GO:0048749 P compound eye development
GO:0048814 P regulation of dendrite morphogenesis
GO:0060253 P negative regulation of glial cell proliferation
GO:0060439 P trachea morphogenesis
GO:0072089 P stem cell proliferation
GO:0090090 P negative regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomaMG_comp24429_c0_seq1
Sequence
(Amino Acid)
MNPPAPGKTATRSGYHQKALAEIRNSLLPFANIGNSEPPGSSAASTVSSGVSSGFSSSSG
NGLDKDLNVLPQSLNQLIALGYDEDPAVRALKYAGGRFDAALDYLSKQQEPLNGVLKSSN
LSALGTKLIRKPSLEREINLHRGSPALDSGAGSSRSDSPRQSEPPPLPHEKLSRQYSPSG
FSEPPPPPPPRCPSTPPVLPSVQQLLKRMSPAPPLPPARGTSPVAAAAPTPPARQPMIVQ
NGPQVQQQLTQQIQALSIYQTGGGGELPPPYPMSGGPPPPPPSV
(93 a.a.)

- SilkBase 1999-2023 -