SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG12913_5prime_partial:A_BomaMG_comp24344_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0004871 F obsolete signal transducer activity
GO:0005388 F P-type calcium transporter activity
GO:0005509 F calcium ion binding
GO:0005524 F ATP binding
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006828 P manganese ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0007165 P signal transduction
GO:0008152 P metabolic process
GO:0008544 P epidermis development
GO:0015410 F ABC-type manganese transporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0016787 F hydrolase activity
GO:0030026 P cellular manganese ion homeostasis
GO:0030145 F manganese ion binding
GO:0031532 P actin cytoskeleton reorganization
GO:0032468 P Golgi calcium ion homeostasis
GO:0032472 P Golgi calcium ion transport
GO:0034220 P ion transmembrane transport
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0046872 F metal ion binding
GO:0070588 P calcium ion transmembrane transport
GO:0071421 P manganese ion transmembrane transport
RNA-seq EntryA_BomaMG_comp24344_c0_seq1
Sequence
(Amino Acid)
RPLLLNGLLYAAIIIAGTLWVFNREMSDNTITPRDTTMTFTCFVLFDMFNALSCRSQTKS
VFEVGLLSNRMFLAAVTLSLLGQALVIYFPPLQSVFQTEALTAHDILFLVGLTSSVFIVS
EIKKLIERTLKKRVYGKYAAKAHDAMDFV
*(49 a.a.)

- SilkBase 1999-2023 -