| Name | O_BomaMG12818_internal:A_BomaMG_comp24305_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005774 |
C |
vacuolar membrane |
| GO:0005886 |
C |
plasma membrane |
| GO:0005887 |
C |
integral component of plasma membrane |
| GO:0006457 |
P |
protein folding |
| GO:0006812 |
P |
cation transport |
| GO:0006874 |
P |
cellular calcium ion homeostasis |
| GO:0008152 |
P |
metabolic process |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016023 |
C |
cytoplasmic vesicle |
| GO:0016787 |
F |
hydrolase activity |
| GO:0016887 |
F |
ATP hydrolysis activity |
| GO:0019829 |
F |
ATPase-coupled cation transmembrane transporter activity |
| GO:0046872 |
F |
metal ion binding |
| GO:0098655 |
P |
cation transmembrane transport |
|
| RNA-seq Entry | A_BomaMG_comp24305_c0_seq1 |
Sequence
(Amino Acid) | LLPARGCTLHFDALLLTGTAVLNESMLTGESVPVGKTALLRVDKPFDMKEHAASILFCGT
RVIQTRYYNNEPVRALVLRTGYNTSKGQLVRSILYPVPADFKFDRDSYKFIIILAGIAAR
(39 a.a.) |
