SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG12808_complete:A_BomaMG_comp24299_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000124 C SAGA complex
GO:0001075 F RNA polymerase II general transcription initiation factor activity
GO:0001129 F obsolete RNA polymerase II transcription factor activity, TBP-class protein binding, involved in preinitiation complex assembly
GO:0004402 F histone acetyltransferase activity
GO:0005634 C nucleus
GO:0005669 C transcription factor TFIID complex
GO:0006351 P transcription, DNA-templated
GO:0006352 P DNA-templated transcription, initiation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0007221 P positive regulation of transcription of Notch receptor target
GO:0008134 F transcription factor binding
GO:0022008 P neurogenesis
GO:0042803 F protein homodimerization activity
GO:0043966 P histone H3 acetylation
GO:0046982 F protein heterodimerization activity
GO:0051123 P RNA polymerase II preinitiation complex assembly
RNA-seq EntryA_BomaMG_comp24299_c0_seq1
Sequence
(Amino Acid)
MSNNSLAQAANMPTIGTVGQGAIQYVNNPMQSPQLQNTSIQGSPSQHSPMGTQSQVAKVG
QGGAGDQSSQLLSRPRLQELVREVDPTVQLDEEVEEMLLQLADDFIDTTLNSACALAKHR
HAPNVELRDVQLHLERQWNMWIPGFGNDELRPYKRAAVTEAHRQRMALIRKSIKKY
*(58 a.a.)

- SilkBase 1999-2023 -