SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG12779_complete:A_BomaMG_comp24283_c0_seq5
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000785 C chromatin
GO:0000790 C chromatin
GO:0000792 C heterochromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001701 P in utero embryonic development
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006346 P DNA methylation-dependent heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007420 P brain development
GO:0007507 P heart development
GO:0007568 P aging
GO:0008327 F methyl-CpG binding
GO:0009888 P tissue development
GO:0014070 P response to organic cyclic compound
GO:0016573 P histone acetylation
GO:0016575 P histone deacetylation
GO:0016581 C NuRD complex
GO:0031492 F nucleosomal DNA binding
GO:0031667 P response to nutrient levels
GO:0032355 P response to estradiol
GO:0043044 P chromatin remodeling
GO:0043234 C protein-containing complex
GO:0044030 P regulation of DNA methylation
GO:0048568 P embryonic organ development
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomaMG_comp24283_c0_seq5
Sequence
(Amino Acid)
MNISIERKRSDCSALPKGWQREEVVRKTGLSAGKVDVYYYSPTGKKFRSKPELVRYLGDS
VDLSCFDFQQGQINTMLLCKAKKARAQFDYRGVRNDASLVPPIRQTASIFKQPVTVYKTQ
DSKVKTDLKHGTQEKPKQLFWEKRLEGLTACDANGVIGTTSLPKYIKSLGPYTSDATTIQ
SLATALHVSSQPITGQIGSKQAIKDNPGVFLNPEQPLIAAVTITKEDVRRQEERVKRARQ
RLRQALSVA
*(82 a.a.)

- SilkBase 1999-2023 -