SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG12760_5prime_partial:A_BomaMG_comp24273_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0005680 C anaphase-promoting complex
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008284 P positive regulation of cell population proliferation
GO:0010997 F anaphase-promoting complex binding
GO:0016567 P protein ubiquitination
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0031572 P mitotic G2 DNA damage checkpoint signaling
GO:0031965 C nuclear membrane
GO:0040020 P regulation of meiotic nuclear division
GO:0045732 P positive regulation of protein catabolic process
GO:0051301 P cell division
GO:0051488 P positive regulation of ubiquitin protein ligase activity
GO:0070306 P lens fiber cell differentiation
GO:0090344 P negative regulation of cell aging
GO:0097027 F ubiquitin-protein transferase activator activity
RNA-seq EntryA_BomaMG_comp24273_c0_seq1
Sequence
(Amino Acid)
HQHGLLASGGGTADRCIRFWNTLTSQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQI
LVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFSKTPSHKENKSV
LNLYTALR
*(42 a.a.)

- SilkBase 1999-2023 -