SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG12315_5prime_partial:A_BomaMG_comp24103_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001046 F core promoter sequence-specific DNA binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007623 P circadian rhythm
GO:0009267 P cellular response to starvation
GO:0030282 P bone mineralization
GO:0035019 P somatic stem cell population maintenance
GO:0042752 P regulation of circadian rhythm
GO:0045672 P positive regulation of osteoclast differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:1901653 P cellular response to peptide
RNA-seq EntryA_BomaMG_comp24103_c0_seq1
Sequence
(Amino Acid)
RPSPRTLKAHARTHTGERPFRCAWPGCERRFSRSDELSRHKRTHTGEKKFECRVCNRRFM
RSDHLAKHVKRHAKEKAPLTPVLRLLPSPPVALPVRPVVAAAQ
*(33 a.a.)

- SilkBase 1999-2023 -