SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG12148_complete:A_BomaMG_comp24043_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000103 P sulfate assimilation
GO:0001666 P response to hypoxia
GO:0005515 F protein binding
GO:0005730 C nucleolus
GO:0005739 C mitochondrion
GO:0006457 P protein folding
GO:0006662 P glycerol ether metabolic process
GO:0006979 P response to oxidative stress
GO:0007584 P response to nutrient
GO:0008113 F peptide-methionine (S)-S-oxide reductase activity
GO:0009725 P response to hormone
GO:0009749 P response to glucose
GO:0014070 P response to organic cyclic compound
GO:0015035 F protein-disulfide reductase activity
GO:0030425 C dendrite
GO:0031669 P cellular response to nutrient levels
GO:0032403 F protein-containing complex binding
GO:0033743 F peptide-methionine (R)-S-oxide reductase activity
GO:0034599 P cellular response to oxidative stress
GO:0042493 P response to xenobiotic stimulus
GO:0043025 C neuronal cell body
GO:0045454 P cell redox homeostasis
GO:0048678 P response to axon injury
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomaMG_comp24043_c0_seq3
Sequence
(Amino Acid)
MSNAICKSLRSPVRNLTSLKKAISTSLVHNETILVRNNEEFINKVMNNDKPVIVNFHAEW
CEPCKILTPQLKKLIEPLTDLDLAVVDVEDNADLVHTFEVKAVPAVIAIKNGLIVDKFIG
LVETDMITCLINRMSGKKKEGT
*(46 a.a.)

- SilkBase 1999-2023 -