SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG12054_complete:A_BomaMG_comp24002_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0000780 C condensed chromosome, centromeric region
GO:0000942 C outer kinetochore
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007063 P regulation of sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0009790 P embryo development
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0051301 P cell division
GO:0051983 P regulation of chromosome segregation
GO:0071173 P spindle assembly checkpoint signaling
GO:2001244 P positive regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp24002_c0_seq1
Sequence
(Amino Acid)
MSLFPEGTTFKELIATEGFTCTEMREGKPWTYQTDLYCLAGTIHVILMGSYMKVANRLGQ
WNIDKKLPRYMKVSLWDKIFTTLLNVPDCKNLPDLMDLKNEVDSVLHEVDNLGSQLRNFA
NVLKSR
*(41 a.a.)

- SilkBase 1999-2023 -