SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG11967_3prime_partial:A_BomaMG_comp23977_c0_seq5
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005765 C lysosomal membrane
GO:0005794 C Golgi apparatus
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0008089 P anterograde axonal transport
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0019882 P antigen processing and presentation
GO:0030117 C membrane coat
GO:0030424 C axon
GO:0033365 P protein localization to organelle
GO:0035646 P endosome to melanosome transport
GO:0043195 C terminal bouton
GO:0048007 P antigen processing and presentation, exogenous lipid antigen via MHC class Ib
GO:0048490 P anterograde synaptic vesicle transport
GO:0048499 P synaptic vesicle membrane organization
GO:0051138 P positive regulation of NK T cell differentiation
GO:0061088 P regulation of sequestering of zinc ion
GO:0072657 P protein localization to membrane
GO:1904115 C axon cytoplasm
RNA-seq EntryA_BomaMG_comp23977_c0_seq5
Sequence
(Amino Acid)
MSRILKSHPKSVQAHKDLVSACLDDKDESIRLRALGLLYGMVSKKNLMEIVKKLMSHMER
AEGTLYRDELLTRMIEICSQNNYQHVVDFEWYITVLAELTEMETSAKHGCIIAAQLTEVG
ARVADVRP
(41 a.a.)

- SilkBase 1999-2023 -