SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG11942_complete:A_BomaMG_comp23968_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0001894 P tissue homeostasis
GO:0005391 F P-type sodium:potassium-exchanging transporter activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005890 C sodium:potassium-exchanging ATPase complex
GO:0005918 C septate junction
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006813 P potassium ion transport
GO:0006814 P sodium ion transport
GO:0006883 P cellular sodium ion homeostasis
GO:0007268 P chemical synaptic transmission
GO:0007605 P sensory perception of sound
GO:0007626 P locomotory behavior
GO:0007630 P jump response
GO:0008152 P metabolic process
GO:0008324 F cation transmembrane transporter activity
GO:0008340 P determination of adult lifespan
GO:0008344 P adult locomotory behavior
GO:0008360 P regulation of cell shape
GO:0009266 P response to temperature stimulus
GO:0009612 P response to mechanical stimulus
GO:0010107 P potassium ion import across plasma membrane
GO:0010248 P establishment or maintenance of transmembrane electrochemical gradient
GO:0015991 P proton transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016787 F hydrolase activity
GO:0019991 P septate junction assembly
GO:0030007 P cellular potassium ion homeostasis
GO:0035152 P regulation of tube architecture, open tracheal system
GO:0035158 P regulation of tube diameter, open tracheal system
GO:0035159 P regulation of tube length, open tracheal system
GO:0036376 P sodium ion export across plasma membrane
GO:0046872 F metal ion binding
GO:0050905 P neuromuscular process
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0060439 P trachea morphogenesis
RNA-seq EntryA_BomaMG_comp23968_c0_seq4
Sequence
(Amino Acid)
MAYGQIGMIQAAAGFFVYFVIMAENGFLPMKLFGIRKQWDSKAINDLTDSYGQEWTYRDR
KALEFTCHTAFFVSIVVVQWADLIICKTRRNSIIHQGMRNWALNFGLIFETALAAFLSYT
PGMDKGLRMYPLKFVWWLPAIPFMLSIFIYDEIRRFYLRRNPGGWLEQETYY
*(56 a.a.)

- SilkBase 1999-2023 -