SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG11868_internal:A_BomaMG_comp23957_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0001932 P regulation of protein phosphorylation
GO:0002262 P myeloid cell homeostasis
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005829 C cytosol
GO:0007166 P cell surface receptor signaling pathway
GO:0008440 F inositol-1,4,5-trisphosphate 3-kinase activity
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030217 P T cell differentiation
GO:0032957 P inositol trisphosphate metabolic process
GO:0033030 P negative regulation of neutrophil apoptotic process
GO:0035726 P common myeloid progenitor cell proliferation
GO:0045059 P positive thymic T cell selection
GO:0045061 P thymic T cell selection
GO:0045638 P negative regulation of myeloid cell differentiation
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0046638 P positive regulation of alpha-beta T cell differentiation
GO:0071277 P cellular response to calcium ion
RNA-seq EntryA_BomaMG_comp23957_c1_seq1
Sequence
(Amino Acid)
GYDQMKISLLDVPWNEDYTEASSDDLSSEWDSDVPEPAPAQTYKQSERWRKLRNIVQWTP
FFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLSPQEEKCFELLMKDILRPFVPEFKG
QVTCEDGELYLQLQDLL
(44 a.a.)

- SilkBase 1999-2023 -