SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG11835_complete:A_BomaMG_comp23946_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004016 F adenylate cyclase activity
GO:0004383 F guanylate cyclase activity
GO:0004672 F protein kinase activity
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006182 P cGMP biosynthetic process
GO:0006468 P protein phosphorylation
GO:0007166 P cell surface receptor signaling pathway
GO:0007168 P receptor guanylyl cyclase signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007589 P body fluid secretion
GO:0008074 C guanylate cyclase complex, soluble
GO:0008217 P regulation of blood pressure
GO:0008528 F G protein-coupled peptide receptor activity
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016525 P negative regulation of angiogenesis
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0016941 F natriuretic peptide receptor activity
GO:0017046 F peptide hormone binding
GO:0019901 F protein kinase binding
GO:0030308 P negative regulation of cell growth
GO:0030828 P obsolete positive regulation of cGMP biosynthetic process
GO:0035556 P intracellular signal transduction
GO:0035810 P positive regulation of urine volume
GO:0035815 P positive regulation of renal sodium excretion
GO:0042312 P blood vessel diameter maintenance
GO:0042417 P dopamine metabolic process
GO:0042562 F hormone binding
GO:0043114 P regulation of vascular permeability
GO:0043235 C receptor complex
GO:0048662 P negative regulation of smooth muscle cell proliferation
GO:0050880 P blood vessel diameter maintenance
GO:1903779 P regulation of cardiac conduction
RNA-seq EntryA_BomaMG_comp23946_c0_seq1
Sequence
(Amino Acid)
MEQYANNLETLVSERTQDYLEEKKKCEELLYQLLPKSVASQLINGQSVVAETFEQVTIYF
SDIVGFTALSASSTPMQVVDLLNDLYTCFDSIVENYDVYKVETIGDAYMVVSGLPERNGT
RHACEVARMALALLDAVRRFRIRHRPMDQLKLRIGLHSGPCVAGVVGLKMPRYCLFGDTV
NTASRMESNGEALKIHVSPDTKALLDTFGTFHLECRGEVAMKGKGILVTYWLLGEKTDPN
APKEKPSLVKNQTLSTESGSLSHLTPFRQRMEQNSRSSSRRGSGVFQQRSIDVTKLEKET
QPLLQSLAIQRQLSDPTEPVANGIDNEESDKLSVSNSISLNVNSLSHNHQGHPRVKLKEA
NSINHKSKVGNNNWISKLPTASNSFDNGTKKASERLKDYSSVPLLSKVDTPNDSIV
*(138 a.a.)

- SilkBase 1999-2023 -