SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG1178_complete:A_BomaMG_comp12041_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_tyrosine-protein_kinase_Src42A-like_isoform_X4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0006099 P tricarboxylic acid cycle
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007254 P JNK cascade
GO:0007275 P multicellular organism development
GO:0007391 P dorsal closure
GO:0007395 P dorsal closure, spreading of leading edge cells
GO:0007411 P axon guidance
GO:0007424 P open tracheal system development
GO:0007435 P salivary gland morphogenesis
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019233 P sensory perception of pain
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0034332 P adherens junction organization
GO:0036335 P intestinal stem cell homeostasis
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0042127 P regulation of cell population proliferation
GO:0042742 P defense response to bacterium
GO:0043277 P apoptotic cell clearance
GO:0045087 P innate immune response
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0046529 P imaginal disc fusion, thorax closure
GO:0048749 P compound eye development
GO:0051017 P actin filament bundle assembly
GO:0090136 P epithelial cell-cell adhesion
RNA-seq EntryA_BomaMG_comp12041_c0_seq2
Sequence
(Amino Acid)
MMNADLAFRAESQRARNQKWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDFSLSV
RDGDTVKHYRIRQLDEGGFFIARRTTFRTLQELVEHYSKDADGLCVALNKPCVQIEKPVT
EGLSHRTRDQWEIDRASLKFVRKLGHGQFGEVWEGLWNNTTPVAVKTLKSGTMDPKDFLA
EAQIMKKLRHNKLIQLYAVCTLEEPIYIITELMKHGSLLDYLQGKGRGLKLQQLIDMAAQ
IAAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKEDEYEARVGARFPIKWT
APEAANYSKFSIKSDVWSFGILLTELVTYGRTPYPGMTNAEVLHQVEHGYRMPCPQNCLP
ALYEIMLECWHKDPLKRPTFETLQWKLEDFFTMDNSEYKEASTY
*(134 a.a.)

- SilkBase 1999-2023 -