SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG11789_complete:A_BomaMG_comp23940_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001819 P positive regulation of cytokine production
GO:0002376 P immune system process
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006935 P chemotaxis
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007565 P female pregnancy
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010819 P regulation of T cell chemotaxis
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0016936 F galactoside binding
GO:0019899 F enzyme binding
GO:0030246 F carbohydrate binding
GO:0032496 P response to lipopolysaccharide
GO:0032689 P negative regulation of interferon-gamma production
GO:0032722 P positive regulation of chemokine production
GO:0032732 P positive regulation of interleukin-1 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0032815 P negative regulation of natural killer cell activation
GO:0032823 P regulation of natural killer cell differentiation
GO:0033081 P regulation of T cell differentiation in thymus
GO:0043032 P positive regulation of macrophage activation
GO:0043322 P negative regulation of natural killer cell degranulation
GO:0043539 F protein serine/threonine kinase activator activity
GO:0045089 P positive regulation of innate immune response
GO:0045185 P maintenance of protein location
GO:0045591 P positive regulation of regulatory T cell differentiation
GO:0050728 P negative regulation of inflammatory response
GO:0051353 P positive regulation of oxidoreductase activity
GO:0071902 P positive regulation of protein serine/threonine kinase activity
GO:0098586 P cellular response to virus
GO:1900426 P positive regulation of defense response to bacterium
GO:1902714 P negative regulation of interferon-gamma production
GO:2000316 P regulation of T-helper 17 type immune response
GO:2000406 P positive regulation of T cell migration
GO:2000562 P negative regulation of CD4-positive, alpha-beta T cell proliferation
GO:2000679 P positive regulation of transcription regulatory region DNA binding
GO:2000778 P positive regulation of interleukin-6 production
GO:2001181 P positive regulation of interleukin-10 production
RNA-seq EntryA_BomaMG_comp23940_c0_seq1
Sequence
(Amino Acid)
MAVPPIYNPVIPCVHPIPGGMYPGRMLRIQGRVPPGAQRFAINLQCGPNTDPRDDIALHL
NFRFVEMCVVRNHLSNMSWGAEETAGGMPLHANGETFEALVLCEPRALKVALNGVHFCEF
PHRLQYQRISHLTVDGDVLVQFIGFEGAQPPPPANMYMSEPPVYGGYGAPPPAYGAPGYG
PQQGFY
*(61 a.a.)

- SilkBase 1999-2023 -