SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG11733_3prime_partial:A_BomaMG_comp23904_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001933 P negative regulation of protein phosphorylation
GO:0002686 P negative regulation of leukocyte migration
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0006612 P protein targeting to membrane
GO:0006810 P transport
GO:0006897 P endocytosis
GO:0008270 F zinc ion binding
GO:0015031 P protein transport
GO:0016567 P protein ubiquitination
GO:0017112 F guanyl-nucleotide exchange factor activity
GO:0017137 F small GTPase binding
GO:0031982 C vesicle
GO:0033004 P negative regulation of mast cell activation
GO:0043305 P negative regulation of mast cell degranulation
GO:0043547 P positive regulation of GTPase activity
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0046872 F metal ion binding
GO:0048261 P negative regulation of receptor-mediated endocytosis
GO:0050728 P negative regulation of inflammatory response
GO:0055037 C recycling endosome
GO:0060368 P regulation of Fc receptor mediated stimulatory signaling pathway
GO:0061630 F ubiquitin protein ligase activity
GO:1900165 P negative regulation of interleukin-6 production
GO:1900235 P negative regulation of Kit signaling pathway
RNA-seq EntryA_BomaMG_comp23904_c0_seq2
Sequence
(Amino Acid)
MITSKMPSLRIDQNDLKCKNGCDYFGNPQWQGYCSKCHREQMQRQRKAEKASSFTSTLPR
SDQRKSERGLKLSSHASFSKFEEKRLRQSETLKKTNLLKFNVFKKNITDDHEIPAERRQP
EFKIPTAVFEGMKADFRVRFPSFPPQIDRDARGFVHTFILDVIKWAAIMNVDELSERVQK
QYQRFMKHMETSQHYASVDSDARELLIDFVEKHAMTYLHELPSIVFSPSGTDDERQDRAM
SERIQQLSWVGEKHLECKLDRNNAECRRLLYKAISELLGMDAARWSGAKLARVRR
(97 a.a.)

- SilkBase 1999-2023 -