SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG11572_internal:A_BomaMG_comp23824_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0004366 F glycerol-3-phosphate O-acyltransferase activity
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005743 C mitochondrial inner membrane
GO:0005886 C plasma membrane
GO:0006631 P fatty acid metabolic process
GO:0006637 P acyl-CoA metabolic process
GO:0006641 P triglyceride metabolic process
GO:0006650 P glycerophospholipid metabolic process
GO:0008152 P metabolic process
GO:0008374 F O-acyltransferase activity
GO:0008654 P phospholipid biosynthetic process
GO:0009749 P response to glucose
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016024 P CDP-diacylglycerol biosynthetic process
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0019432 P triglyceride biosynthetic process
GO:0040018 P positive regulation of multicellular organism growth
GO:0042104 P positive regulation of activated T cell proliferation
GO:0044255 P cellular lipid metabolic process
GO:0050707 P regulation of cytokine production
GO:0051607 P defense response to virus
GO:0055089 P fatty acid homeostasis
GO:0055091 P phospholipid homeostasis
GO:0070236 P negative regulation of activation-induced cell death of T cells
GO:0070970 P interleukin-2 production
RNA-seq EntryA_BomaMG_comp23824_c0_seq1
Sequence
(Amino Acid)
ATAAGLPLVFVPLHRSHFDYILVTFALYLTGLRPPLVAAGDNMRIPFFGWILRGCGAFYI
RRRVDGSEHNGDPVYKAALRSYIINSLAANNNLEFFIEGGRTRTGKPQPPKAGILSVIMD
AYLDGTIDDALLVPVTLNYDKLVDGNFVREQLGMPKQMETFWSALRGIWRTMNTNHGSIR
VDFNQPISLKELVQSFKKYNHFKAPIEAPLGPADDKFSSDLDRRLLYNHSHSSLYGDDVS
TDHKMMVEAIGRHIVYEGAQATAVMCTNVVSYVLLTEARGGAGVRR
(94 a.a.)

- SilkBase 1999-2023 -