SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG1151_internal:A_BomaMG_comp11996_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_LOW_QUALITY_PROTEIN:_tuberin_[Bombyx_mori]
Ontology
GO:0001843 P neural tube closure
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006469 P negative regulation of protein kinase activity
GO:0006606 P protein import into nucleus
GO:0006897 P endocytosis
GO:0007050 P regulation of cell cycle
GO:0007507 P heart development
GO:0008104 P protein localization
GO:0008285 P negative regulation of cell population proliferation
GO:0014067 P negative regulation of phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016192 P vesicle-mediated transport
GO:0019902 F phosphatase binding
GO:0030100 P regulation of endocytosis
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0031267 F small GTPase binding
GO:0032007 P negative regulation of TOR signaling
GO:0033596 C TSC1-TSC2 complex
GO:0042803 F protein homodimerization activity
GO:0043491 P protein kinase B signaling
GO:0043547 P positive regulation of GTPase activity
GO:0046626 P regulation of insulin receptor signaling pathway
GO:0046627 P negative regulation of insulin receptor signaling pathway
GO:0048009 P insulin-like growth factor receptor signaling pathway
GO:0048471 C perinuclear region of cytoplasm
GO:0050918 P positive chemotaxis
GO:0051056 P regulation of small GTPase mediated signal transduction
GO:0051726 P regulation of cell cycle
GO:0051898 P negative regulation of protein kinase B signaling
RNA-seq EntryA_BomaMG_comp11996_c0_seq1
Sequence
(Amino Acid)
ALAPYHSCLEPQTQQRIVRCLLKYGMVLRSPQPYINALTIFTLETRDTMVKMLPEVLLDL
SKISDTKAIASPMLEFLSTLTRLPKVFASFVEDQYMSVFAILLPYTNPSRYNHYAVSLAH
HVIAAWFLKCRLSYRRNFVRFIIHGLHNYIIMPFEEQLQYKSNFQHGAANEDSSNRQRSS
S
(59 a.a.)

- SilkBase 1999-2023 -