SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG11435_complete:A_BomaMG_comp23752_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002092 P positive regulation of receptor internalization
GO:0005576 C extracellular region
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005771 C multivesicular body
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0007155 P cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0007166 P cell surface receptor signaling pathway
GO:0012505 C endomembrane system
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016477 P cell migration
GO:0031226 C intrinsic component of plasma membrane
GO:0031902 C late endosome membrane
GO:0035646 P endosome to melanosome transport
GO:0042470 C melanosome
GO:0045807 P positive regulation of endocytosis
GO:0048757 P pigment granule maturation
GO:0070062 C extracellular exosome
GO:0097487 C multivesicular body, internal vesicle
GO:1900746 P regulation of vascular endothelial growth factor signaling pathway
GO:2001046 P positive regulation of integrin-mediated signaling pathway
RNA-seq EntryA_BomaMG_comp23752_c0_seq1
Sequence
(Amino Acid)
MCCPEFIAKYVLFIANLVFSLAGLAIIGLGVAVLINLRDLQDILPVNALPIGIIVLGCII
FIIAFLACCGAVKESRCMLITYSIFMVILVAVKIYLAIVVFGFLSDVTSTITSWVTTAFN
TSSLRDLYHVMEALFNCCGTTGPSSYDGILSQLPPSCCASPVDNTCYAPNAFPGCTTRLI
DYFETFGGAIGSVLIIIIFLEFISIIFAWFLSHSYSQKRRGNIA
*(74 a.a.)

- SilkBase 1999-2023 -