SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG11332_complete:A_BomaMG_comp23714_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000060 P obsolete protein import into nucleus, translocation
GO:0001654 P eye development
GO:0001752 P compound eye photoreceptor fate commitment
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007380 P specification of segmental identity, head
GO:0007383 P specification of segmental identity, antennal segment
GO:0007420 P brain development
GO:0007422 P peripheral nervous system development
GO:0007432 P salivary gland boundary specification
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007479 P leg disc proximal/distal pattern formation
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007525 P somatic muscle development
GO:0008134 F transcription factor binding
GO:0009954 P proximal/distal pattern formation
GO:0010092 P specification of animal organ identity
GO:0034504 P protein localization to nucleus
GO:0035282 P segmentation
GO:0035326 F cis-regulatory region sequence-specific DNA binding
GO:0042659 P regulation of cell fate specification
GO:0045664 P regulation of neuron differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048735 P haltere morphogenesis
GO:0048749 P compound eye development
GO:0060323 P head morphogenesis
GO:0090098 P positive regulation of BMP signaling pathway
RNA-seq EntryA_BomaMG_comp23714_c0_seq1
Sequence
(Amino Acid)
MAQPRYDESLHGGGYMEGGAMYHEHRLTHPHLAPVHYPPPAAPAHALPGEPLVHKRDKDA
IYGHPLFPLLALIFEKCELATCTPRDPGVAGGDVCSSESFNEDIAVFSKQIRQEKPYYIA
DPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERETARPPD
ANGEPRSAPDSSHDGASTPDVVSTPYTKSHLIQRRDPQLAPNSTTSYLVHPCS
*(77 a.a.)

- SilkBase 1999-2023 -