SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG11316_complete:A_BomaMG_comp23703_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0002474 P antigen processing and presentation of peptide antigen via MHC class I
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005783 C endoplasmic reticulum
GO:0005784 C Sec61 translocon complex
GO:0005789 C endoplasmic reticulum membrane
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006915 P apoptotic process
GO:0006921 P cellular component disassembly involved in execution phase of apoptosis
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007283 P spermatogenesis
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016192 P vesicle-mediated transport
GO:0030136 C clathrin-coated vesicle
GO:0032403 F protein-containing complex binding
GO:0032471 P negative regulation of endoplasmic reticulum calcium ion concentration
GO:0032580 C Golgi cisterna membrane
GO:0033116 C endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0035584 P calcium-mediated signaling using intracellular calcium source
GO:0042288 F MHC class I protein binding
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051561 P positive regulation of mitochondrial calcium ion concentration
GO:0070973 P protein localization to endoplasmic reticulum exit site
GO:0071556 C integral component of lumenal side of endoplasmic reticulum membrane
GO:0097038 C perinuclear endoplasmic reticulum
GO:1903071 P positive regulation of ER-associated ubiquitin-dependent protein catabolic process
GO:1904154 P positive regulation of retrograde protein transport, ER to cytosol
GO:2001244 P positive regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp23703_c0_seq1
Sequence
(Amino Acid)
MSIQWTFIAGYLYFEIALVMLMILPIFSPRRWNQFFKSRLFSMFRENVAVYFYVFIGVLA
LFLIDAVREIRKYSNVTDVSHTHLATEMKTHVKLFRAQRNFYIIGFAIFLTFVIRRLITM
LIIQDELKQKAEKIIKQAEETVKQAKTSILANTLQSEELQHYDEINSQLEETKILLKLEK
DRVKLLEDDVKMWQQKCEEAIASKPGKGDE
*(69 a.a.)

- SilkBase 1999-2023 -