SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG11183_complete:A_BomaMG_comp23656_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		lola_[Danaus_plexippus]
Ontology
GO:0001964 P startle response
GO:0002121 P inter-male aggressive behavior
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0007464 P R3/R4 cell fate commitment
GO:0007526 P larval somatic muscle development
GO:0008406 P gonad development
GO:0010906 P regulation of glucose metabolic process
GO:0016199 P axon midline choice point recognition
GO:0019730 P antimicrobial humoral response
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0031987 P locomotion involved in locomotory behavior
GO:0035167 P larval lymph gland hemopoiesis
GO:0044719 P regulation of imaginal disc-derived wing size
GO:0045467 P R7 cell development
GO:0045476 P nurse cell apoptotic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048813 P dendrite morphogenesis
GO:0048854 P brain morphogenesis
RNA-seq EntryA_BomaMG_comp23656_c0_seq2
Sequence
(Amino Acid)
MERSQDEIMNSSDNAREQQVAQLYTPYMLGYGTAGLSSGKAGWTLYECVDCGNKYKHKGS
LQRHIKYECRKQPSFKCPYCVYRAYQKHNLLLHERHLHKDMPEKVDFVSE
*(36 a.a.)

- SilkBase 1999-2023 -