SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG11089_complete:A_BomaMG_comp23613_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_centromere_protein_S-like_[Papilio_xuthus]
Ontology
GO:0000712 P resolution of meiotic recombination intermediates
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003690 F double-stranded DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005829 C cytosol
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007062 P sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0031297 P replication fork processing
GO:0031398 P positive regulation of protein ubiquitination
GO:0034080 P CENP-A containing chromatin assembly
GO:0036297 P interstrand cross-link repair
GO:0043240 C Fanconi anaemia nuclear complex
GO:0046982 F protein heterodimerization activity
GO:0051301 P cell division
GO:0071821 C FANCM-MHF complex
RNA-seq EntryA_BomaMG_comp23613_c0_seq1
Sequence
(Amino Acid)
MSAFEDLSASQRLRAALKRDVTAVCLESTLGLEITKPAMDLILELIYKKLSVYASDLEVF
ARHARRCKIQGEDVKLLVRRNKSLRSQLESRSPTAALKRKSSLAEDIFEDASSNFDEPAM
KDKMRKEEPPMEDAIDMTVENVVDLTAD
*(48 a.a.)

- SilkBase 1999-2023 -