SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG11056_internal:A_BomaMG_comp23596_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)		Zinc_finger_protein_846_[Papilio_machaon]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000976 F transcription cis-regulatory region binding
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005794 C Golgi apparatus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006461 P protein-containing complex assembly
GO:0007276 P gamete generation
GO:0010629 P negative regulation of gene expression
GO:0021762 P substantia nigra development
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
RNA-seq EntryA_BomaMG_comp23596_c2_seq1
Sequence
(Amino Acid)
DHTASAHQFANLELVVYDRTKNNRNRDAAIKIDVTDIACKLCTQTVNNLEELIHHLIIAH
DAEYDMSVPNCLLPFKLDKDQPTCPTCDMKFVFFEYLLRHANKHHLSHHYICDVCGTSFQ
GENHLKMHYRYYHREGGYTCEYC
(46 a.a.)

- SilkBase 1999-2023 -