SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10950_internal:A_BomaMG_comp23554_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		UDP-glycosyltransferase_UGT50A1_precursor_[Bombyx_mori]
Ontology
GO:0002175 P protein localization to paranode region of axon
GO:0003851 F 2-hydroxyacylsphingosine 1-beta-galactosyltransferase activity
GO:0005886 C plasma membrane
GO:0006629 P lipid metabolic process
GO:0006665 P sphingolipid metabolic process
GO:0006682 P galactosylceramide biosynthetic process
GO:0006687 P glycosphingolipid metabolic process
GO:0007010 P cytoskeleton organization
GO:0007417 P central nervous system development
GO:0007422 P peripheral nervous system development
GO:0008152 P metabolic process
GO:0008489 F UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity
GO:0009813 P flavonoid biosynthetic process
GO:0015020 F glucuronosyltransferase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016740 F transferase activity
GO:0016757 F glycosyltransferase activity
GO:0016758 F hexosyltransferase activity
GO:0030913 P paranodal junction assembly
GO:0043231 C intracellular membrane-bounded organelle
GO:0047263 F N-acylsphingosine galactosyltransferase activity
GO:0048812 P neuron projection morphogenesis
GO:0052696 P flavonoid glucuronidation
RNA-seq EntryA_BomaMG_comp23554_c0_seq1
Sequence
(Amino Acid)
DHDANAAKAEVDGYAKKLEFQHLTSDKLHEAIQEVINNPKYRREVKYRQNLLRDQKESPL
DRAVYWTEYVIRHKGAYHLQSPAKDLSFIQYYLLDVAMLFVMSAL
(34 a.a.)

- SilkBase 1999-2023 -