| Name | O_BomaMG10921_5prime_partial:A_BomaMG_comp23540_c1_seq3 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_aladin_[Amyelois_transitella] |
| Ontology |
| GO:0003674 |
F |
molecular_function |
| GO:0005634 |
C |
nucleus |
| GO:0005635 |
C |
nuclear envelope |
| GO:0005643 |
C |
nuclear pore |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0005813 |
C |
centrosome |
| GO:0006406 |
P |
mRNA export from nucleus |
| GO:0006409 |
P |
tRNA export from nucleus |
| GO:0006810 |
P |
transport |
| GO:0006913 |
P |
nucleocytoplasmic transport |
| GO:0007077 |
P |
mitotic nuclear membrane disassembly |
| GO:0007612 |
P |
learning |
| GO:0009566 |
P |
fertilization |
| GO:0010827 |
P |
regulation of glucose transmembrane transport |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0016032 |
P |
viral process |
| GO:0016925 |
P |
protein sumoylation |
| GO:0019083 |
P |
viral transcription |
| GO:0031047 |
P |
gene silencing by RNA |
| GO:0031965 |
C |
nuclear membrane |
| GO:0046822 |
P |
regulation of nucleocytoplasmic transport |
| GO:0051028 |
P |
mRNA transport |
| GO:0075733 |
P |
intracellular transport of virus |
| GO:1900034 |
P |
regulation of cellular response to heat |
|
| RNA-seq Entry | A_BomaMG_comp23540_c1_seq3 |
Sequence
(Amino Acid) | DTSMLVWDTAMETAIPLRRVAGGGNVFARWSFDASKIFTATSSIIFRIWDTKTWTPERWC
ARGHRVVSACWGPDNILLFAAKGEPMVYALTTTSLLSGSQTTKATPALDVTKVELSSGEP
VGGPILDMCWDPTGRYMAMLFEESHLVAVFCTTYIMMQLKIDPCCFVTGVEDEIPCTMAF
QQNFYDGACLTIAWSSGRVQHFPIIYSESY
*(69 a.a.) |
