SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10820_3prime_partial:A_BomaMG_comp23488_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ras-related_protein_Ral-a_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006886 P intracellular protein transport
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007265 P Ras protein signal transduction
GO:0007298 P border follicle cell migration
GO:0007391 P dorsal closure
GO:0007464 P R3/R4 cell fate commitment
GO:0008152 P metabolic process
GO:0008593 P regulation of Notch signaling pathway
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0022604 P regulation of cell morphogenesis
GO:0030165 F PDZ domain binding
GO:0045087 P innate immune response
GO:0045824 P negative regulation of innate immune response
GO:0046329 P negative regulation of JNK cascade
GO:0050829 P defense response to Gram-negative bacterium
RNA-seq EntryA_BomaMG_comp23488_c0_seq1
Sequence
(Amino Acid)
MSKKPAAQPTLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQ
IDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEPESFDATQEFREQILRVKNDDNIPFL
LVGNKSDLADKRRVPLETCRERAHNWQVPYVETSAKTRDNVDKMELCWFMFCSLPDNSEY
WMDCGLCSGVLRPDE
(64 a.a.)

- SilkBase 1999-2023 -