SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10743_complete:A_BomaMG_comp23439_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_postreplication_repair_E3_ubiquitin-protein_ligase_RAD18-like_isoform_X1_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0016567 P protein ubiquitination
GO:0016605 C PML body
GO:0016874 F ligase activity
GO:0030521 P androgen receptor signaling pathway
GO:0031491 F nucleosome binding
GO:0032184 F SUMO polymer binding
GO:0033234 P negative regulation of protein sumoylation
GO:0033768 C SUMO-targeted ubiquitin ligase complex
GO:0042802 F identical protein binding
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046685 P response to arsenic-containing substance
GO:0046872 F metal ion binding
GO:0050681 F androgen receptor binding
GO:0051865 P protein autoubiquitination
GO:0061630 F ubiquitin protein ligase activity
GO:0070534 P protein K63-linked ubiquitination
GO:0070936 P protein K48-linked ubiquitination
GO:0070979 P protein K11-linked ubiquitination
GO:0085020 P protein K6-linked ubiquitination
GO:0090169 P regulation of spindle assembly
GO:0090234 P regulation of kinetochore assembly
RNA-seq EntryA_BomaMG_comp23439_c0_seq2
Sequence
(Amino Acid)
MELTCSLCKKTTKQNEIIVTTTCGHIFHDDCIQESLKSSHTCPECHKPIKNESLLRLYLN
VGDESLEIESEIKYLSLKLKKIQQLLKKDEKECEDWNRAITSERDCLNSITKQLEMFKKN
YNDIEASNPLSRKEMQDLYTELKEFNVDRIEDVELVVETIGSLLKEN
*(55 a.a.)

- SilkBase 1999-2023 -