SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10599_internal:A_BomaMG_comp23363_c4_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC101739897_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000775 C chromosome, centromeric region
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0005722 C beta-heterochromatin
GO:0006281 P DNA repair
GO:0006336 P DNA replication-independent chromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0008347 P glial cell migration
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0032508 P DNA duplex unwinding
GO:0042585 C germinal vesicle
GO:0046328 P regulation of JNK cascade
GO:0051276 P chromosome organization
GO:0070868 P obsolete heterochromatin organization involved in chromatin silencing
GO:0097193 P intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp23363_c4_seq1
Sequence
(Amino Acid)
VNEFIERRGDGLDSRKRTRNPRYRKSKKFLLEREKQLKTLSKELYGEAEGGPSGKGCGNH
LFKGRRNIRKVIDKKSLTHRTVLANVEELDRKRRLLARQTRLREHLGCEEDVSVMVINDE
VCLEYDFEENRPVVTIHPFFTKVMKAHQYEGVKFMWDACFE
(52 a.a.)

- SilkBase 1999-2023 -