SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10545_complete:A_BomaMG_comp23335_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_CREB-binding_protein_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000123 C histone acetyltransferase complex
GO:0000790 C chromatin
GO:0000987 F cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001105 F transcription coactivator activity
GO:0001191 F obsolete transcriptional repressor activity, RNA polymerase II transcription factor binding
GO:0001666 P response to hypoxia
GO:0002039 F p53 binding
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003712 F transcription coregulator activity
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006461 P protein-containing complex assembly
GO:0006473 P protein acetylation
GO:0007165 P signal transduction
GO:0007219 P Notch signaling pathway
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0008283 P cell population proliferation
GO:0008589 P regulation of smoothened signaling pathway
GO:0016032 P viral process
GO:0016407 F acetyltransferase activity
GO:0016573 P histone acetylation
GO:0016604 C nuclear body
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0018076 P N-terminal peptidyl-lysine acetylation
GO:0032481 P positive regulation of type I interferon production
GO:0033613 F DNA-binding transcription factor binding
GO:0034212 F peptide N-acetyltransferase activity
GO:0034644 P cellular response to UV
GO:0042592 P homeostatic process
GO:0042733 P embryonic digit morphogenesis
GO:0042975 F peroxisome proliferator activated receptor binding
GO:0042981 P regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043426 F MRF binding
GO:0044255 P cellular lipid metabolic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0060355 P positive regulation of cell adhesion molecule production
GO:0061418 P regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0070555 P response to interleukin-1
GO:0098609 P cell-cell adhesion
GO:1900034 P regulation of cellular response to heat
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
GO:1901224 P positive regulation of NIK/NF-kappaB signaling
GO:1904837 P beta-catenin-TCF complex assembly
RNA-seq EntryA_BomaMG_comp23335_c0_seq1
Sequence
(Amino Acid)
MADEPPNKRPKMIRDPFQGPSDSTADGFSNLDMFDLEKDLPDELMGGPWGEQPGVPGPKP
PAQGLGPGQMAPQQQLNGDDPAAAMHRQINNHLLQVFSQGNKSGLVGHNNPLGLSSLGSK
SPNLQSPPNVSVSKDLMGGMHQLMPNTSHPNQLHSTMPMSSIQGGMNVTNVGNMIVTNSN
MTGAGMLGSGIINNVNKQLPTLMGNSHHGTHHPHAQAIQNGPIGGRVGGVGMQAPNIRAP
LQHHPRMQAPGGGGHPLAPYHPTYGQSATGAGAAAGAPLPQRPAGVRFGPSGEMGAGGGG
AAAAVPPAPSPQTPGAPAGGQSQPQAATQAPAQQPAGPQQPPAGSIADPEKRKLIQQQLV
LLLHAHKCQRRESQSNGESWQCYLPHCKTMKGVLNHMMSCQAGKSCTVPHCSSSRQIINH
WKHCNKNDCPVCLPLKQADRTRSINAAAGGQAPHVTTGVASGVTGGVASGVGGGGGTGGM
ASVGIGVGSGGTVQGTIGVAQQLSAPTQEANMKRAYEALGITCPTSVPNMGGGFPRAPVR
MPAPRPPPLTDVVPQQQTQSVQSLFSHQPQPDMQTQQQQQQPQQQTQTQQQQQQQQLNII
LTQMGTGSLQLPGGAVTANPVSGTKEWHQSITADLRNHLVHKLVQAIFPTPDPSAMLDKR
MHNLVAYARKVEGDMYEMACTRSEYYHLLAEKIYKIQKELEEKRQKKKRATTVGRPGCTA
TSAAAGPVTGAASATRCWKCRPGRRRCWRGRRCQGGTGPWRAGRDRTSRHAHSFARHRTL
HAHGKTALPEQPCGTART
*(265 a.a.)

- SilkBase 1999-2023 -