SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10535_5prime_partial:A_BomaMG_comp23331_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_gamma-tubulin_complex_component_4_[Bombyx_mori]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0000922 C spindle pole
GO:0000923 C equatorial microtubule organizing center
GO:0000930 C gamma-tubulin complex
GO:0005200 F structural constituent of cytoskeleton
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005816 C spindle pole body
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0007020 P microtubule nucleation
GO:0007052 P mitotic spindle organization
GO:0007058 P spindle assembly involved in female meiosis II
GO:0007067 P mitotic cell cycle
GO:0007112 P male meiosis cytokinesis
GO:0008274 C gamma-tubulin large complex
GO:0031122 P cytoplasmic microtubule organization
GO:0043015 F gamma-tubulin binding
GO:0044732 C mitotic spindle pole body
GO:0045450 P bicoid mRNA localization
GO:0051011 F microtubule minus-end binding
GO:0051297 P centrosome cycle
GO:0051298 P centrosome duplication
GO:0051415 P microtubule nucleation by interphase microtubule organizing center
GO:0090063 P positive regulation of microtubule nucleation
GO:0090307 P mitotic spindle assembly
RNA-seq EntryA_BomaMG_comp23331_c2_seq1
Sequence
(Amino Acid)
KKAHATFLADILSQSFLTVTLSSDSDCSGDPADTLNNPVFCNIMELLKLCHSFCSMSEIA
NDREAEDYYIKGYSERFNKLVKQLMQLLVSLRDRPCGVYLARLLMRLDYNRWLSREAQLT
QSVTNMLRY
*(42 a.a.)

- SilkBase 1999-2023 -