SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10532_5prime_partial:A_BomaMG_comp23330_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		putative_tyrosine-protein_kinase_jak2_[Danaus_plexippus]
Ontology
GO:0000166 F nucleotide binding
GO:0000186 P obsolete activation of MAPKK activity
GO:0002250 P adaptive immune response
GO:0002376 P immune system process
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005131 F growth hormone receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0006979 P response to oxidative stress
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0008022 F protein C-terminus binding
GO:0008284 P positive regulation of cell population proliferation
GO:0008631 P intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0009755 P hormone-mediated signaling pathway
GO:0010667 P negative regulation of cardiac muscle cell apoptotic process
GO:0010811 P positive regulation of cell-substrate adhesion
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016363 C nuclear matrix
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0019221 P cytokine-mediated signaling pathway
GO:0019901 F protein kinase binding
GO:0020037 F heme binding
GO:0022408 P negative regulation of cell-cell adhesion
GO:0030218 P erythrocyte differentiation
GO:0030335 P positive regulation of cell migration
GO:0031103 P axon regeneration
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0031702 F type 1 angiotensin receptor binding
GO:0031959 P mineralocorticoid receptor signaling pathway
GO:0032024 P positive regulation of insulin secretion
GO:0032516 P positive regulation of phosphoprotein phosphatase activity
GO:0032731 P positive regulation of interleukin-1 beta production
GO:0033130 F acetylcholine receptor binding
GO:0033160 P obsolete positive regulation of protein import into nucleus, translocation
GO:0033194 P response to hydroperoxide
GO:0033209 P tumor necrosis factor-mediated signaling pathway
GO:0034612 P response to tumor necrosis factor
GO:0035401 F histone kinase activity (H3-Y41 specific)
GO:0035409 P histone H3-Y41 phosphorylation
GO:0035556 P intracellular signal transduction
GO:0035722 P interleukin-12-mediated signaling pathway
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042169 F SH2 domain binding
GO:0042393 F histone binding
GO:0042503 P tyrosine phosphorylation of STAT protein
GO:0042506 P tyrosine phosphorylation of STAT protein
GO:0042508 P tyrosine phosphorylation of STAT protein
GO:0042517 P positive regulation of tyrosine phosphorylation of STAT protein
GO:0042977 P activation of Janus kinase activity
GO:0043065 P positive regulation of apoptotic process
GO:0043388 P positive regulation of DNA binding
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043548 F phosphatidylinositol 3-kinase binding
GO:0043560 F insulin receptor substrate binding
GO:0045087 P innate immune response
GO:0045429 P positive regulation of nitric oxide biosynthetic process
GO:0045597 P positive regulation of cell differentiation
GO:0045822 P negative regulation of heart contraction
GO:0046677 P response to antibiotic
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0050727 P regulation of inflammatory response
GO:0050729 P positive regulation of inflammatory response
GO:0050867 P positive regulation of cell activation
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051428 F peptide hormone receptor binding
GO:0051770 P positive regulation of nitric-oxide synthase biosynthetic process
GO:0060333 P interferon-gamma-mediated signaling pathway
GO:0060396 P growth hormone receptor signaling pathway
GO:0060397 P growth hormone receptor signaling pathway via JAK-STAT
GO:0060548 P negative regulation of cell death
GO:0070671 P response to interleukin-12
GO:1902728 P positive regulation of growth factor dependent skeletal muscle satellite cell proliferation
GO:1904037 P positive regulation of epithelial cell apoptotic process
GO:1904707 P positive regulation of vascular associated smooth muscle cell proliferation
RNA-seq EntryA_BomaMG_comp23330_c0_seq2
Sequence
(Amino Acid)
GLDDALHDCDAWASPRLMESIVSQGKTYLVTLTKKIGSGNYGHVFKGWMERDNQESHRKE
VAIKKLTRQASERNGTLYEDFKNELEIMKSLQHINIVEILGYAWDQGPEVLIVMEYLEEG
SLNYYLKFQGEKLRISHLLKYCKDIATGMDHVSAKNVVHRDLATRNILVVNKYHVKISDF
GLARIIPKEENTYRLKTERLLPINWYAPESAVEPWHFSTKSDVWSYGVTAWEIFTRARQE
VPKFDVDRPRERASCFQIPEECPSEIFRYLMKECWALDPNLRPRFIDLIHTCKRFIAEYQ
*(99 a.a.)

- SilkBase 1999-2023 -