SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10531_5prime_partial:A_BomaMG_comp23330_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_tyrosine-protein_kinase_hopscotch_[Papilio_machaon]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0006954 P inflammatory response
GO:0007165 P signal transduction
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007260 P tyrosine phosphorylation of STAT protein
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0019221 P cytokine-mediated signaling pathway
GO:0020037 F heme binding
GO:0030218 P erythrocyte differentiation
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0035401 F histone kinase activity (H3-Y41 specific)
GO:0035409 P histone H3-Y41 phosphorylation
GO:0035556 P intracellular signal transduction
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042127 P regulation of cell population proliferation
GO:0042393 F histone binding
GO:0042977 P activation of Janus kinase activity
GO:0042981 P regulation of apoptotic process
GO:0045087 P innate immune response
GO:0046777 P protein autophosphorylation
GO:0060397 P growth hormone receptor signaling pathway via JAK-STAT
RNA-seq EntryA_BomaMG_comp23330_c0_seq1
Sequence
(Amino Acid)
GLDDALHDCDAWASPRLMESIVSQGKTYLVTLTKKIGSGNYGHVFKGWMERDNQESHRKE
VAIKKLTRQASERNGTLYEDFKNELEIMKSLQHINIVEILGYAWDQGPEVLIVMEYLEEG
SLNYYLKFQGEKLRISHLLKYCKDIATGMDHVSAKNVVHRDLATRNILVVNKYHVKISDF
GLARIIPKEENTYRLKTERLLPINWYAPESAVEPWHFSTKSDVWSYGVTAWEIFTRARQE
VPKFDVDRPRERASW
*(84 a.a.)

- SilkBase 1999-2023 -