SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG10459_complete:A_BomaMG_comp23291_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
GTP-binding_nuclear_protein_Ran_[Bombyx_mori]
Ontology
GO:0000054 P ribosomal subunit export from nucleus
GO:0000132 P establishment of mitotic spindle orientation
GO:0000166 F nucleotide binding
GO:0000212 P meiotic spindle organization
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005811 C lipid droplet
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005875 C microtubule associated complex
GO:0005880 C nuclear microtubule
GO:0005938 C cell cortex
GO:0006606 P protein import into nucleus
GO:0006611 P protein export from nucleus
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006913 P nucleocytoplasmic transport
GO:0007015 P actin filament organization
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007155 P cell adhesion
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007346 P regulation of mitotic cell cycle
GO:0008152 P metabolic process
GO:0008360 P regulation of cell shape
GO:0009267 P cellular response to starvation
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0032880 P regulation of protein localization
GO:0048812 P neuron projection morphogenesis
GO:0051301 P cell division
GO:0072686 C mitotic spindle
RNA-seq EntryA_BomaMG_comp23291_c0_seq1
Sequence
(Amino Acid)
MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIRFNV
WDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNK
VDIKDRKVKAKTIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPALL
PPEVTMDPQWQNQIEKDLQDAQNTALPEEDEDL
*(70 a.a.)

- SilkBase 1999-2023 -