SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10450_3prime_partial:A_BomaMG_comp23287_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_focal_adhesion_kinase_1_[Bombyx_mori]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000226 P microtubule cytoskeleton organization
GO:0001525 P angiogenesis
GO:0001568 P blood vessel development
GO:0001570 P vasculogenesis
GO:0001725 C stress fiber
GO:0001764 P neuron migration
GO:0001890 P placenta development
GO:0001932 P regulation of protein phosphorylation
GO:0001934 P positive regulation of protein phosphorylation
GO:0003007 P heart morphogenesis
GO:0003779 F actin binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0004871 F obsolete signal transducer activity
GO:0005088 F guanyl-nucleotide exchange factor activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0006921 P cellular component disassembly involved in execution phase of apoptosis
GO:0007172 P signal complex assembly
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007229 P integrin-mediated signaling pathway
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0008284 P positive regulation of cell population proliferation
GO:0008360 P regulation of cell shape
GO:0008432 F JUN kinase binding
GO:0009790 P embryo development
GO:0010594 P regulation of endothelial cell migration
GO:0010632 P regulation of epithelial cell migration
GO:0014068 P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016324 C apical plasma membrane
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0021955 P central nervous system neuron axonogenesis
GO:0022408 P negative regulation of cell-cell adhesion
GO:0030010 P establishment of cell polarity
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030198 P extracellular matrix organization
GO:0030335 P positive regulation of cell migration
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0033628 P regulation of cell adhesion mediated by integrin
GO:0038007 P netrin-activated signaling pathway
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0038096 P Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0040023 P nuclear migration
GO:0042127 P regulation of cell population proliferation
GO:0042169 F SH2 domain binding
GO:0043066 P negative regulation of apoptotic process
GO:0043087 P regulation of GTPase activity
GO:0043542 P endothelial cell migration
GO:0043547 P positive regulation of GTPase activity
GO:0043552 P positive regulation of phosphatidylinositol 3-kinase activity
GO:0045087 P innate immune response
GO:0045667 P regulation of osteoblast differentiation
GO:0045860 P positive regulation of protein kinase activity
GO:0046621 P negative regulation of organ growth
GO:0046777 P protein autophosphorylation
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0048013 P ephrin receptor signaling pathway
GO:0048870 P cell motility
GO:0050771 P negative regulation of axonogenesis
GO:0051493 P regulation of cytoskeleton organization
GO:0051893 P regulation of focal adhesion assembly
GO:0051897 P positive regulation of protein kinase B signaling
GO:0051964 P negative regulation of synapse assembly
GO:0060396 P growth hormone receptor signaling pathway
GO:0071560 P cellular response to transforming growth factor beta stimulus
GO:1900024 P regulation of substrate adhesion-dependent cell spreading
GO:2000060 P positive regulation of ubiquitin-dependent protein catabolic process
GO:2000811 P negative regulation of anoikis
RNA-seq EntryA_BomaMG_comp23287_c0_seq1
Sequence
(Amino Acid)
MLSKRVTFSLPRHEPEGGGRCGDGALARAMQPAPTGGSPKRHAPIQTHGAVADQSTLKVH
LPNGGFNLVRASPDEDVRSVLRLVASRLASGERVYASCFALRARLSNGKIRWIHQDTPVS
ELLTKWPASEWRLELRVRYLPANLRELCEADRVTFHYYYDQVRHEYLNANHPTVDQELAV
QICCLEIKYFCKDMQISMDKKSNIEYLEKEFGLHKFLPKSVLESIKPKVLKKAIQQQFKK
VANLSDTECMLKYLETMHTHYGYDRETFAGALGTGWFIPVELAIGPDIDISYVSHKAGEP
PTYTKIASFSDIEAVQTLKSNCTQQSQTQTGSCGKAALQLRVKGAAETLTITCSSVEAAE
SLADLVDGYCRLVTDSQTSLWNRTTNVWKQLNCQCKTEMSSSSSEGKTSSWEANTATLLS
EDYAEIVDDDADYSTPAVRDYELVRNQIELTGIIGEGQFGDVHKGTCRVTSANHPSLRRQ
LSIQKQQGKSQSGEYVLPVAVKTCKMDADLDTAEKFLEEAYIMQQFSHPHIIGLVGVCSS
SPIWIVMELATLGEMRAYLQQNAHRLETCQLVLYIYQLSTALSYLESKKFVHRDIAARNV
LVSTPTCVKLADFGLSKMVEDKSYYKASRGKLPIKWMAPESINFRRFTSASDVWMFGVCM
WEILMLGVKPFSGVKNNDVIGKLENGERLALPPRCPPRLYSV
(233 a.a.)

- SilkBase 1999-2023 -