SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10396_complete:A_BomaMG_comp23253_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_transcription_factor_Sp3-like_isoform_X3_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 F cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001503 P ossification
GO:0001779 P natural killer cell differentiation
GO:0001889 P liver development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003690 F double-stranded DNA binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0016605 C PML body
GO:0017053 C transcription repressor complex
GO:0030183 P B cell differentiation
GO:0030217 P T cell differentiation
GO:0030218 P erythrocyte differentiation
GO:0030219 P megakaryocyte differentiation
GO:0030224 P monocyte differentiation
GO:0030324 P lung development
GO:0030851 P granulocyte differentiation
GO:0043353 P enucleate erythrocyte differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048596 P embryonic camera-type eye morphogenesis
GO:0048706 P embryonic skeletal system development
GO:0060216 P definitive hemopoiesis
RNA-seq EntryA_BomaMG_comp23253_c1_seq1
Sequence
(Amino Acid)
MPSRPSTTGQQIQQDPNEPGKWQVVTVSTASSTAASPQECEAAKQRAESPNSSKKHMKRV
ACTCPNCDQGENRVVDRKKQHVCHIAGCNKVYGKTSHLRAHLRWHSGERPFLCNWLFCGK
RFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLAKHVRIHTKNRITEVATSTQSMYS
DSGDDSSDEKMMLTIETIHPEGESEDKLVMIRPGPKVEPEQLDS
*(74 a.a.)

- SilkBase 1999-2023 -