SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10353_5prime_partial:A_BomaMG_comp23234_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_DNA_repair_protein_XRCC3-like_[Papilio_polytes]
Ontology
GO:0000150 F DNA strand exchange activity
GO:0000166 F nucleotide binding
GO:0000400 F four-way junction DNA binding
GO:0000707 P meiotic DNA recombinase assembly
GO:0000722 P telomere maintenance via recombination
GO:0000724 P double-strand break repair via homologous recombination
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0004520 F endodeoxyribonuclease activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005657 C replication fork
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006312 P mitotic recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007131 P reciprocal meiotic recombination
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008821 F crossover junction endodeoxyribonuclease activity
GO:0010033 P response to organic substance
GO:0010212 P response to ionizing radiation
GO:0010824 P regulation of centrosome duplication
GO:0033063 C Rad51B-Rad51C-Rad51D-XRCC2 complex
GO:0033065 C Rad51C-XRCC3 complex
GO:0042148 P strand invasion
GO:0048471 C perinuclear region of cytoplasm
GO:0071140 P resolution of mitotic recombination intermediates
GO:0090267 P positive regulation of mitotic cell cycle spindle assembly checkpoint
GO:0090656 P t-circle formation
RNA-seq EntryA_BomaMG_comp23234_c1_seq1
Sequence
(Amino Acid)
IVIDSIAAPFRVESTNYVQRAGELRELAIMLITLAQQYNIAIVCINQVTASFADSDSIHP
ALGLAWSNMVSTRLKISKTTQSVIIDDSGVCRSDSGGQNKLFARDISVVFAPDLANSSTL
FTITSNGIQSID
*(43 a.a.)

- SilkBase 1999-2023 -