SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10313_complete:A_BomaMG_comp23214_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_transforming_growth_factor_beta-1-induced_transcript_1_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0003713 F transcription coactivator activity
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005925 C focal adhesion
GO:0008270 F zinc ion binding
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0016055 P Wnt signaling pathway
GO:0016331 P morphogenesis of embryonic epithelium
GO:0016363 C nuclear matrix
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030579 P ubiquitin-dependent SMAD protein catabolic process
GO:0030855 P epithelial cell differentiation
GO:0031012 C extracellular matrix
GO:0045165 P cell fate commitment
GO:0045599 P negative regulation of fat cell differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048495 F Roundabout binding
GO:0050681 F androgen receptor binding
GO:0070411 F I-SMAD binding
RNA-seq EntryA_BomaMG_comp23214_c0_seq1
Sequence
(Amino Acid)
MSTKVEAPAVCNSCDKVIQGRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVP
CFTKHHSPRCHGCGDPITDRVIQALGVSWHAHHFVCGGCKKELGGGGFMEQAGRPYCSDC
YADKFATRCKGCGNPIVDKAIIALDAKWHRDCFTCMKCRNPVTDSTFSVMETQPLCGKCA
*(59 a.a.)

- SilkBase 1999-2023 -