SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG1027_internal:A_BomaMG_comp11801_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		putative_pumilio_[Danaus_plexippus]
Ontology
GO:0000288 P nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000900 F translation repressor activity, mRNA regulatory element binding
GO:0001709 P cell fate determination
GO:0003723 F RNA binding
GO:0003730 F mRNA 3'-UTR binding
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0006417 P regulation of translation
GO:0007067 P mitotic cell cycle
GO:0007268 P chemical synaptic transmission
GO:0007275 P multicellular organism development
GO:0007280 P pole cell migration
GO:0007281 P germ cell development
GO:0007616 P long-term memory
GO:0008258 P head involution
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0008595 P anterior/posterior axis specification, embryo
GO:0016441 P posttranscriptional gene silencing
GO:0016477 P cell migration
GO:0017148 P negative regulation of translation
GO:0031594 C neuromuscular junction
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0042078 P germ-line stem cell division
GO:0045727 P positive regulation of translation
GO:0045786 P negative regulation of cell cycle
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0048149 P behavioral response to ethanol
GO:0048477 P oogenesis
GO:0048813 P dendrite morphogenesis
GO:0050804 P modulation of chemical synaptic transmission
GO:0060213 P positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0061176 C type Ib terminal bouton
GO:0061177 C type Is terminal bouton
GO:0097482 C muscle cell postsynaptic specialization
RNA-seq EntryA_BomaMG_comp11801_c0_seq1
Sequence
(Amino Acid)
GAESAGGGLVNGAPSAPDSAHHTPFDVQQLIRSQQAAAAGGQAAAAQLQLLQQQQQQQFQ
LQQQIAAQQAFTQAPYVINTGQEGAPYVSALIAGVPPYYGVAAPWGVYPGLVAQPAQQQA
QQPRRPLTPQQGEQQVNGQGQYV
(46 a.a.)

- SilkBase 1999-2023 -