SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG10262_5prime_partial:A_BomaMG_comp23180_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		hypothetical_protein_KGM_02129_[Danaus_plexippus]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003682 F chromatin binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006354 P DNA-templated transcription, elongation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0016239 P positive regulation of macroautophagy
GO:0019899 F enzyme binding
GO:0032044 C DSIF complex
GO:0032784 P regulation of DNA-templated transcription, elongation
GO:0032785 P negative regulation of DNA-templated transcription, elongation
GO:0032786 P positive regulation of DNA-templated transcription, elongation
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:1900364 P negative regulation of mRNA polyadenylation
RNA-seq EntryA_BomaMG_comp23180_c0_seq1
Sequence
(Amino Acid)
GAGPFTPQTPGAMYGSDHTYSPYSPGRSEGESAEAGAWAAPELVVRLRAGAADGLAAQTA
VVRATGGGSCALYLPAEERVVSVPPDLLEPVLPQAGERVKVIAGEDRDAVGQLISIENQE
GVVKFGTDDIKIMQLRHLCKMAS
*(47 a.a.)

- SilkBase 1999-2023 -