SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG216_internal:A_BomaASG_c1238_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
GTPase-activating_protein_isoform_X2_[Bombyx_mori]
Ontology
GO:0005096 F GTPase activator activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0007062 P sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0007165 P signal transduction
GO:0007265 P Ras protein signal transduction
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008293 P torso signaling pathway
GO:0008595 P anterior/posterior axis specification, embryo
GO:0016321 P female meiosis chromosome segregation
GO:0019233 P sensory perception of pain
GO:0022008 P neurogenesis
GO:0031235 C intrinsic component of the cytoplasmic side of the plasma membrane
GO:0035556 P intracellular signal transduction
GO:0043087 P regulation of GTPase activity
GO:0043547 P positive regulation of GTPase activity
GO:0045678 P positive regulation of R7 cell differentiation
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0046872 F metal ion binding
RNA-seq EntryA_BomaASG_c1238_g1_i1
Sequence
(Amino Acid)
SATLGSRRLLLQYTVDHVFPKNHYRSLEELFLRSVHQKPTTASAVYILGEIVASKTDAAQ
PLVRLFMHHDLIVPIVKELADSEISALTDATTIFRGNTLVSKMMDRSEE
(35 a.a.)

- SilkBase 1999-2023 -