SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG1755_5prime_partial:A_BomaASG_c12680_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		gephyrin_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003824 F catalytic activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0006777 P Mo-molybdopterin cofactor biosynthetic process
GO:0007529 P establishment of synaptic specificity at neuromuscular junction
GO:0008092 F cytoskeletal protein binding
GO:0008152 P metabolic process
GO:0016020 C membrane
GO:0016740 F transferase activity
GO:0018315 P molybdenum incorporation into molybdenum-molybdopterin complex
GO:0019897 C extrinsic component of plasma membrane
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0032324 P molybdopterin cofactor biosynthetic process
GO:0043025 C neuronal cell body
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046872 F metal ion binding
GO:0060077 C inhibitory synapse
GO:0061598 F molybdopterin adenylyltransferase activity
GO:0061599 F molybdopterin molybdotransferase activity
GO:0072579 P glycine receptor clustering
GO:0097112 P gamma-aminobutyric acid receptor clustering
GO:0098794 C postsynapse
RNA-seq EntryA_BomaASG_c12680_g1_i1
Sequence
(Amino Acid)
LLFVIRGLRVCSGKGGSWPRLRAKLAHGVALDPRPEYARADIDVSQDDDMPTVKLLGNQC
SSRLLSACGASVLVELPAASPAHPRLPAGATVPALITGTLHNSAG
*(34 a.a.)

- SilkBase 1999-2023 -