SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1709_internal:A_BomaASG_c12424_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
vacuolar_protein_sorting_4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000815 C ESCRT III complex
GO:0000920 P septum digestion after cytokinesis
GO:0000922 C spindle pole
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005774 C vacuolar membrane
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006900 P vesicle budding from membrane
GO:0006914 P autophagy
GO:0006997 P nucleus organization
GO:0007033 P vacuole organization
GO:0007049 P cell cycle
GO:0007080 P mitotic metaphase plate congression
GO:0008022 F protein C-terminus binding
GO:0008568 F microtubule-severing ATPase activity
GO:0009838 P abscission
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0016197 P endosomal transport
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0019058 P viral life cycle
GO:0019076 P viral release from host cell
GO:0019904 F protein domain specific binding
GO:0030496 C midbody
GO:0031122 P cytoplasmic microtubule organization
GO:0031902 C late endosome membrane
GO:0032367 P intracellular cholesterol transport
GO:0032466 P negative regulation of cytokinesis
GO:0032880 P regulation of protein localization
GO:0034058 P endosomal vesicle fusion
GO:0036258 P multivesicular body assembly
GO:0039702 P viral budding via host ESCRT complex
GO:0042623 F ATP hydrolysis activity
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0048471 C perinuclear region of cytoplasm
GO:0051301 P cell division
GO:0061738 P late endosomal microautophagy
GO:0070062 C extracellular exosome
GO:0072319 P vesicle uncoating
GO:0090543 C Flemming body
GO:0090611 P ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway
GO:1902188 P obsolete positive regulation of viral release from host cell
GO:1903076 P regulation of protein localization to plasma membrane
GO:1903543 P positive regulation of exosomal secretion
GO:1903774 P positive regulation of viral budding via host ESCRT complex
GO:1903902 P positive regulation of viral life cycle
GO:1904896 P ESCRT complex disassembly
GO:1904903 P ESCRT III complex disassembly
RNA-seq EntryA_BomaASG_c12424_g1_i1
Sequence
(Amino Acid)
IPWKGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLVSKWLGESEKLVKNLFDLAR
QHKPSIIFIDEIDSLCSSRSDNESESARRIKTEFLVQMQGVGNDMDGILVLGATNIPWAL
D
(39 a.a.)

- SilkBase 1999-2023 -