SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1591_internal:A_BomaASG_c11478_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
cell_cycle_checkpoint_kinase_2_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006282 P regulation of DNA repair
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007281 P germ cell development
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016607 C nuclear speck
GO:0016740 F transferase activity
GO:0035234 P ectopic germ cell programmed cell death
GO:0044773 P mitotic DNA damage checkpoint signaling
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050321 F tau-protein kinase activity
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0071480 P cellular response to gamma radiation
GO:0072332 P intrinsic apoptotic signaling pathway by p53 class mediator
RNA-seq EntryA_BomaASG_c11478_g1_i1
Sequence
(Amino Acid)
IITDLSHNGTFVNGEDIGKGNSRVLDDNDVISVTHRIVKIFIFKDLLKNEQDQVPKEISQ
KYYISRVLGQGACGLVKLVYDKIKCTKHAMKIIKKSRLTNGQINHINKP
(35 a.a.)

- SilkBase 1999-2023 -