SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1587_internal:A_BomaASG_c11461_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
neural-cadherin_isoform_X4_[Bombyx_mori]
Ontology
GO:0004872 F signaling receptor activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005911 C cell-cell junction
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007411 P axon guidance
GO:0007412 P axon target recognition
GO:0007413 P axonal fasciculation
GO:0008013 F beta-catenin binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016318 P ommatidial rotation
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0019233 P sensory perception of pain
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031290 P retinal ganglion cell axon guidance
GO:0042803 F protein homodimerization activity
GO:0044331 P cell-cell adhesion mediated by cadherin
GO:0045296 F cadherin binding
GO:0045463 P R8 cell development
GO:0045467 P R7 cell development
GO:0046872 F metal ion binding
GO:0048675 P axon extension
GO:0048814 P regulation of dendrite morphogenesis
GO:0048841 P regulation of axon extension involved in axon guidance
GO:0048846 P axon extension involved in axon guidance
GO:0050774 P negative regulation of dendrite morphogenesis
GO:0050839 F cell adhesion molecule binding
RNA-seq EntryA_BomaASG_c11461_g1_i1
Sequence
(Amino Acid)
CSYWRCNDNKMQPGSKDILVYSYQGLSPDTEIGRVYVYDLDDWDLPDKKFFWENTENPNF
TLNEETGMITMKQKTREGRYHLKFKVYDRKHTQTDVPANVTVYVKEISHE
(35 a.a.)

- SilkBase 1999-2023 -