SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG1534_internal:A_BomaASG_c10870_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		cell_division_cycle_protein_16_homolog_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005680 C anaphase-promoting complex
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005876 C spindle microtubule
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007088 P regulation of mitotic nuclear division
GO:0008283 P cell population proliferation
GO:0016567 P protein ubiquitination
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051301 P cell division
GO:0051436 P obsolete negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051437 P obsolete positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0051439 P obsolete regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0070979 P protein K11-linked ubiquitination
RNA-seq EntryA_BomaASG_c10870_g1_i1
Sequence
(Amino Acid)
DLMRSLVKQYSELGQWTSAFFWADAAAAAAGGGPEGPSGDDMWLLASAMLARGELHRAAE
VVTSRNLHKRHLLCLGVAMRAHLAAKESSTALNLLEDCDPMLLEPRNTDQTHNRALAGVL
VTQAR
(40 a.a.)

- SilkBase 1999-2023 -