SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaASG1525_3prime_partial:A_BomaASG_c10724_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
zinc_transporter_2_isoform_X1_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005770 C late endosome
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006829 P zinc ion transport
GO:0008021 C synaptic vesicle
GO:0008324 F cation transmembrane transporter activity
GO:0010043 P response to zinc ion
GO:0015633 F ABC-type zinc transporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030672 C synaptic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0031902 C late endosome membrane
GO:0043005 C neuron projection
GO:0045202 C synapse
GO:0051050 P positive regulation of transport
GO:0055085 P transmembrane transport
GO:0061088 P regulation of sequestering of zinc ion
GO:0071577 P zinc ion transmembrane transport
GO:0098655 P cation transmembrane transport
RNA-seq EntryA_BomaASG_c10724_g1_i1
Sequence
(Amino Acid)
MSDELEARMWDESGSRYESRSRDTFFESAFASSEHLDRAPLLAEETYSDVPVTSATEPEH
CHWPQAEPPSAIPQLLTALVLCAFFMVCELIGGYLAGSLSVMSDA
(34 a.a.)

- SilkBase 1999-2023 -