SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaASG1508_internal:A_BomaASG_c10479_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Dystrophin_[Operophtera_brumata]
Ontology
GO:0003779 F actin binding
GO:0005198 F structural molecule activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0007274 P neuromuscular synaptic transmission
GO:0007474 P imaginal disc-derived wing vein specification
GO:0008092 F cytoskeletal protein binding
GO:0008270 F zinc ion binding
GO:0008307 F structural constituent of muscle
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0016010 C dystrophin-associated glycoprotein complex
GO:0016020 C membrane
GO:0030010 P establishment of cell polarity
GO:0042383 C sarcolemma
GO:0045202 C synapse
GO:0046716 P muscle cell cellular homeostasis
GO:0046872 F metal ion binding
GO:0046928 P regulation of neurotransmitter secretion
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0050699 F WW domain binding
RNA-seq EntryA_BomaASG_c10479_g1_i1
Sequence
(Amino Acid)
DVDALADCVVVVEDDAAAENEVTEIEDQLTALSERWSHTCSWTTQQLQLLEQMQEEWTQL
QQAYQTLHDECQQYESTLKEMEANPACEIGSALSRVSELRAVRRGLAAAGRGAAELGA
(38 a.a.)

- SilkBase 1999-2023 -